Forums | MacLife

IntegraG4 · 2003-01-21 7:22 am

I just got into work and one of the PCs I have running FAH has done 1200 of a 6000 WU!! Holy Crap!! Anyone else seen one of these?

DerekCarrillo · 2003-01-21 9:26 am

You should be ableto edit the log file and find out the name of the work unti you are working on.

Here is a link to the current units being run..
http://folding.stanford.edu/psummary.html

I have had a look and I can not see any units that work on that scale, (6000 steps) have a look at your log file for your unit name then look it up on the link to see what your unit is worth points wise.

belloq · 2003-01-21 9:30 am

There are no Folding proteins currently listed over 400 frames per unit. I personally have not seen this either.

Could it be something confusing from a GAH unit?

IntegraG4 · 2003-01-21 10:48 am

i realize this is long as hell and I've deleted a few of the middle parts. Kinda looks like it couldn't even send it. It processed it fairly quickly though... just in the last few hours.

[12:30:20] + Processing work unit
[12:30:20] Core required: FahCore_c9.exe
[12:30:20] Core found.
[12:30:20] Working on Unit 03 [January 21 12:30:20]
[12:30:20] + Working ...
[12:30:20] Genome@Home2 Core Version 2.02 (Sept 5, 2002)
[12:30:20]
[12:30:20] Proj: work/wudata_03
[12:30:20] Finding work files
[12:30:20] sizeof(CORE_PACKET_HDR) = 512
[12:30:21] Checking frame files
[12:30:21] - Couldn't open work/wudata_03.chk
[12:30:21] Starting from initial work packet
[12:30:21]
[12:30:21] Updating shared core-client information
[12:30:21] - Writing "work/wudata_03.key": (overwrite)successful.
[12:30:21] Key file to update shared file: work/wudata_03.key
[12:30:21] keyfile: 0 30 200 15 2 1 0
[12:30:21] Protein: 1tst/pdb1tst.xyz
[12:30:21] - Frames Completed: 0, Remaining: 6000
[12:30:21] - Dynamic steps required: 1200000
[12:30:21]
[12:30:21] Printed current.prm
[12:30:21] Writing local files:
[12:30:21] - Writing "work/wudata_03.key": (overwrite)successful.
[12:30:21] - Writing "work/wudata_03.xyz": (overwrite)successful.
[12:30:21] - Writing "work/wudata_03.prm": (overwrite)successful.
[12:30:22] [SPA] project name: work/wudata_03.
[12:30:22] [SPA] 1 0
[12:30:22] [SPA] Initializing protein design algorithm
[12:30:22] [SPA] seed = 0
[12:30:22] [SPA] Initialization complete
[12:30:22] [SPA] Writing current.pdb, chainlength = 30
[12:30:22] [SPA] Writing current.xyz
[12:30:22] [SPA] Filtering . . .
[12:30:22] [Filter] 30 positions to filter
[12:30:22] [Filter] 30 positions to filter
[12:30:22] [Filter] 1 filtered
[12:30:22] [Filter] 2 filtered
[12:30:22] [Filter] 3 filtered
[12:30:23] [Filter] 4 filtered
[12:30:29] [Filter] 5 filtered
[12:30:29] [Filter] 6 filtered
[12:30:29] [Filter] 7 filtered
[12:30:29] [Filter] 8 filtered
[12:30:30] [Filter] 9 filtered
[12:30:31] [Filter] 10 filtered
[12:30:31] [Filter] 11 filtered
[12:30:31] [Filter] 12 filtered
[12:30:31] [Filter] 13 filtered
[12:30:31] [Filter] 14 filtered
[12:30:31] [Filter] 15 filtered
[12:30:31] [Filter] 16 filtered
[12:30:31] [Filter] 17 filtered
[12:30:32] [Filter] 18 filtered
[12:30:34] [Filter] 19 filtered
[12:30:34] [Filter] 20 filtered
[12:30:35] [Filter] 21 filtered
[12:30:35] [Filter] 22 filtered
[12:30:37] [Filter] 23 filtered
[12:30:37] [Filter] 24 filtered
[12:30:38] [Filter] 25 filtered
[12:30:38] [Filter] 26 filtered
[12:30:38] [Filter] 27 filtered
[12:30:39] [Filter] 28 filtered
[12:30:39] [Filter] 29 filtered
[12:30:39] [SPA] Filter complete
[12:30:39] Iterations: 0 of 6000
[12:30:40] Finished
[12:31:41] [SPA] Energy_Lookup
[12:31:41] [SPA] rotamer wheel done
[12:31:41] [SPA] seed: 5937900
[12:31:41] [SPA] Designing protein sequence 1 of 30
[12:32:57] [SPA] 10.0
[12:34:01] [SPA] 20.0
[12:34:57] [SPA] 30.0
[12:35:52] [SPA] 40.0
[12:36:44] [SPA] 50.0
[12:37:35] [SPA] 60.0
[12:38:27] [SPA] 70.0
[12:39:18] [SPA] 80.0
[12:40:10] [SPA] 90.0
[12:41:02] [SPA] 100.0
[12:41:02] [SPA] Sequence 1 completed:
[12:41:02] NKTTLNSNRTESGGGSQTYYAGQDKIVAGS
[12:41:02] Iterations: 200 of 6000

.....CUT....

[16:49:12] [SPA] Sequence 30 completed:
[16:49:12] NKTTLNTYRPASGAGTPTYYPGQNLPVAGS
[16:49:12] Iterations: 6000 of 6000
[16:49:13] Finished
[16:49:13] [SPA] Design complete
[16:49:13] [SPA] completed successfully
[16:49:14]
[16:49:14] Finished Work Unit
[16:49:14] work_hdr.len_arcfile: 49500
[16:49:15] Leaving Run
[16:49:17] - Writing 50012 bytes of core data to disk.
[16:49:17] end (WriteWorkResults)
[16:49:17] - Shutting down core
[16:49:17]
[16:49:17] Genome@Home2 Core Shutdown: FINISHED_UNIT
[16:49:17] can't delete keyfile
[16:49:17] Failed to delete temporary files
[16:49:20] CoreStatus = 64 (100)
[16:49:20] Sending work to server

[16:49:21] + Attempting to send results
[16:49:22] - Couldn't send HTTP request to server
[16:49:22] + Could not connect to Work Server (results)
[16:49:22] - Error: Could not transmit unit 03 (completed January 21). Keeping unit in queue.

[16:49:22] + Attempting to send results
[16:49:23] - Couldn't send HTTP request to server
[16:49:23] + Could not connect to Work Server (results)
[16:49:23] - Error: Could not transmit unit 03 (completed January 21). Keeping unit in queue.
[16:49:23] + Attempting to get work packet
[16:49:23] - Connecting to assignment server
[16:49:24] - Successful: assigned to (171.64.122.120).
[16:49:24] + News From Folding@Home: Welcome to Folding@Home
[16:49:24] Loaded queue successfully.
[16:49:24] - Deadline time not received.
[16:49:26] + Closed connections
[16:49:26]
[16:49:26] + Processing work unit
[16:49:26] Core required: FahCore_65.exe
[16:49:26] Core found.
[16:49:26] Working on Unit 04 [January 21 16:49:26]
[16:49:26] + Working ...
[16:49:27] Folding@Home Client Core Version 2.47 (June 14, 2002)
[16:49:27]
[16:49:27] Proj: work/wudata_04
[16:49:27] nsteps: 5000000 dt: 2.000000 dt_dump: 250.000000 temperature: 296.000000
[16:49:27] xyzfile:
[16:49:27] " 167 p614_trpzip1_nat_23C
[16:49:27] 1 N -16.109667 -8.411824 89.854520 ..."
[16:49:27] keyfile:
[16:49:27] "parameters ./opls.prm
[16:49:27] NOVERSION
[16:49:27] ARCHIVE
[16:49:27]
[16:49:27] cutoff 16.0
[16:49:27] taper 12.0
[16:49:27]
[16:49:27] ..."

belloq · 2003-01-21 11:13 am

It's a Genome unit, as suspected. They can have a lot of iterations, hence the 6000 you saw. It appears to be a test unit, as indicated by the protein name "1tst/pdb1tst.xyz". I'm glad it went quickly for you. smile

The IP address of the assigning server isn't listed in your log file, but it was most likely 171.64.122.125. According to the Server Stats page, that server is rejecting connections right now. I've also seen it happen that some people are every so often getting a protein from the Internal-only server, 171.64.122.110 accidentally (through no fault of their own). Problem is, it may be unavailable externally after you've completed a protein and you're stuck with an essentially unreturnable result.

Can you go back through the log and find out which server assigned the protein to you?

IntegraG4 · 2003-01-21 3:04 pm

kinda wierd.... I got 6.4 points for it because it did return the unit.

[12:30:03] Thank you for your contribution to Folding@home.
[12:30:03] + Number of Units Completed: 22
[12:30:07] + Attempting to get work packet
[12:30:07] - Connecting to assignment server
[12:30:07] - Successful: assigned to (171.64.122.125).
[12:30:07] + News From Folding@Home: Welcome to Folding@Home

came from 171.64.122.125 as you suspected.

Ok well thanks for the info. I was hoping for a monster score for that one! lol lol

belloq · 2003-01-21 11:06 pm

Excellent. I'm glad it finally accepted the unit back. big_smile

Fold on!

Forums | MacLife

#1 2003-01-21 7:22 am

How many points is a 6000 WU???

#2 2003-01-21 9:26 am

Re: How many points is a 6000 WU???

#3 2003-01-21 9:30 am

Re: How many points is a 6000 WU???

#4 2003-01-21 10:48 am

Re: How many points is a 6000 WU???

#5 2003-01-21 11:13 am

Re: How many points is a 6000 WU???

#6 2003-01-21 3:04 pm

Re: How many points is a 6000 WU???

#7 2003-01-21 11:06 pm

Re: How many points is a 6000 WU???

Board footer